PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G004669.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family MYB
Protein Properties Length: 417aa    MW: 46235 Da    PI: 5.6514
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G004669.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.21.1e-191461148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g+WT+eEde+lvd+++++G g+W++ ++  g++R++k+c++rw +yl
  HL.SW.v1.0.G004669.1 14 KGPWTPEEDEKLVDYIRRHGHGSWRALPKLAGLNRCGKSCRLRWTNYL 61
                          79********************************************97 PP

2Myb_DNA-binding51.42.4e-1667112148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                           rg+++++E++l++++++ lG++ W+tIa +++ gRt++++k+ w+++l
  HL.SW.v1.0.G004669.1  67 RGKFSEDEEKLIINLHAVLGNK-WSTIAGHLP-GRTDNEIKNLWNTHL 112
                           89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-25664IPR009057Homeodomain-like
PROSITE profilePS5129418.786961IPR017930Myb domain
SuperFamilySSF466892.27E-3111108IPR009057Homeodomain-like
SMARTSM007179.7E-161363IPR001005SANT/Myb domain
PfamPF002497.4E-181461IPR001005SANT/Myb domain
CDDcd001671.94E-121661No hitNo description
PROSITE profilePS5129425.62562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.3E-2665116IPR009057Homeodomain-like
SMARTSM007171.0E-1366114IPR001005SANT/Myb domain
PfamPF002491.3E-1467112IPR001005SANT/Myb domain
CDDcd001671.64E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    Send to blast
MGRSPSSDEN GLKKGPWTPE EDEKLVDYIR RHGHGSWRAL PKLAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF SEDEEKLIIN LHAVLGNKWS TIAGHLPGRT DNEIKNLWNT HLKKKLLQMG  120
IDPVTHRPRT DLTILSNLPQ LIAAANFASN FLNPTNNTTA WDTSQSPTPS KLQLLHNILQ  180
VLGTSAPTPS PNMEAMLSLL GSVSVSVSAS ASVNHNSQSL QPYMIDEYLR SVQDHYNNNN  240
IISCGLLGSD DHFVINNNNN NNNNNNNAPP LMNNNPMEAT HQQQSIIISL DDNPYTTMSG  300
SKLLSNSANM IIDHHHDDFN HQLPRLVSSA ASPNDNDGDD GNGDDMMLMS SSSDSKNQNN  360
KSNNRANNNY SSSSTNFDQA WGDLIEDDHE PTDEDSCYWK DIMELASSQT LVNLVD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-29121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010087464.11e-120Transcription factor
TrEMBLW9QDG21e-120W9QDG2_9R
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.22e-94myb domain protein 9